LL-37
Published · Researched 2026-09-21
Overview
LL-37 is the only human cathelicidin antimicrobial peptide — the C-terminal fragment (residues 134–170) of the human cationic antimicrobial protein 18 (hCAP-18), produced endogenously by neutrophils and epithelial cells in skin, gut, and airways as part of innate immunity. Its 37-amino-acid amphipathic alpha-helical structure lets it insert into bacterial membranes, and it acts as an immune-signaling molecule (chemotaxis, TLR modulation) and tissue-repair mediator (angiogenesis, keratinocyte migration). In the gray-market research space it is sold as lyophilized research peptide, typically 5 mg and 10 mg vials, and is the flagship antimicrobial peptide of the mold/Lyme/CIRS biohacker community in 2026.
Social standing
Overall pulse: very high visibility, deeply polarized. LL-37 is one of the most discussed immune peptides on Instagram in 2026, with a parallel, more anecdotal stream in Facebook groups and Threads.
Platform-by-platform:
- Instagram (highest volume): Peptide-educator reels dominate. Standouts: @mikesheffer_ (56K, IFBB Pro/"Peptide & Longevity Guru", July 8, 2026 — 1.7K likes, 1.1K comments) pitching LL-37 as the top antimicrobial for mold and biofilms; @drtrevorbachmeyer (2.1M, Dec 2025 — 2.8K likes, 3.4K comments) with a deep-dive "immune monster/biological command module" monologue that functions as a sales funnel (uniform "DM me" replies, heavy coordinated spartanlab.shop spam); @jacksonjgage (25K, Aug 31, 2026) "Attack. Alarm. Repair." educational carousel with positive but cautious commenters (one raised negative/cancer studies; creator replied with correlation-vs-causation arguments); @drharis.rana (120K, TRT physician, July 2026) warning LL-37 is "a whole different animal" with too much risk, ~100 mcg SC dosing commonly seen online, local reactions (redness, swelling, pain); @breedlove_22 (130K verified, Aug 2026) crediting LL-37 + TA1 for knocking out cold symptoms ("99.9% resolved" — personal anecdote, UNVERIFIED). Vendor/educator infographics from @pept.ix (10 mg vial, research-only framing), @researchpeptidehq (50–250 mcg dosing examples), @thepepedit (honest "limited human data" takeaway), @peptaralabs_io (Sept 2026 — evidence tier rated preclinical plus one small 34-person topical wound trial from 2014).
- Facebook (highest signal, group anecdotes): Jan 2026 group post by Scott Alleson describing a 5-day LL-37 trial for decade-long folliculitis with visible scalp clearing ("injection", admin method per his reply); comments became a sourcing help-desk with scam warnings: "Absolutely be aware of scams.. but don't discourage somebody that needs relief." FB reels: @molecularindex (July 2026) framing endogenous production vs. toxicity tradeoff; VISION HEALTH peptide-team reel (LL-37 & VIP for mold/SIRS/Lyme); HNR-adjacent educational content.
- Threads: Valerie Orsoni (biohacker, verified, 13K, March 2026, posted in French) publicly disclosed a travel protocol: LL-37 200 µg/day × 15 days (OBSERVED community data, UNVERIFIED), reconstituted with bacteriostatic water; threads-cli also surfaced a "Therapeutic Peptide Cheatsheet" listing LL-37 as "heavy duty anti-microbial."
Viral moments: The Sheffer mold/biofilm reel (1.1K comments, polarized) and the Bachmeyer "immune monster" reel (3.4K comments, 2.1M-follower reach) are the two biggest engagement events of 2026.
Recurring praise: mold/biofilm/Lyme protocols ("the only protocol outside certain medications that has permanently fixed their autoimmune issues" — podcast co-host claim, UNVERIFIED); sinus infections ("Works too…. Helps w my sinus infections"); rapid cold recovery; folliculitis clearing; wound/biofilm action.
Recurring complaints / failure modes: (1) mast cell activation warnings — the most heated safety debate; (2) autoimmune contraindications (Hashimoto's specifically flagged); (3) bleeding reports in comments; (4) painful local injection-site reactions; (5) vendor spam and scam-vendor warnings; (6) thin human evidence base (preclinical + one small topical trial); (7) dual pro-inflammatory nature (rosacea/psoriasis links).
Representative quotes (attributed):
- "Appreciate ur content man, but for the sake of anyone else following here that is extremely unsafe advise." — Instagram commenter on the @mikesheffer_ mold/biofilm reel, July 2026
- "I wish I had done more of my own research on LL-37 before I started taking it" — Instagram commenter, same reel
- "I've been running this and I vouch this one is a monster" — Instagram commenter on the @drtrevorbachmeyer LL-37 reel, Dec 2025
- "Absolutely be aware of scams.. but don't discourage somebody that needs relief." — Facebook group commenter in Scott Alleson's folliculitis thread, Jan 2026
- "I have mycotoxins. Where can I read more about this LL37?" — Instagram commenter on @guthealthbyjoy's LL-37 reel, July 2026
Social validation
Tier 1 — FB Groups + IG owner/educator content + Threads all present with item-specific discussion.
Named sources and what each proves:
- https://www.instagram.com/reel/DajAT3DSudn/ — @mikesheffer_ (56K) mold/biofilm reel, July 8, 2026: proves LL-37's anchor position in the mold/CIRS protocol conversation and the polarized safety debate (1.1K comments).
- https://www.instagram.com/reel/DSd2FDkkn-_/ — @drtrevorbachmeyer (2.1M) explainer, Dec 2025: proves mass-market reach and the sales-funnel/vendor-spam dynamic around LL-37.
- https://www.instagram.com/p/DcRAz7CKqc9/ — @pept.ix infographic, Aug 2026: proves 10 mg vial as standard retail form and vendor "research only" framing.
- https://www.instagram.com/reel/DbJYr5xjWYk/ — @drharis.rana (120K) cautionary reel, July 2026: proves the physician-skeptic counter-narrative and documents community-observed ~100 mcg dosing and injection-site reactions.
- https://www.facebook.com/groups/123564747680095/permalink/25944715635138319/ — Scott Alleson FB group post, Jan 2026: proves real owner experimentation (folliculitis, 5-day trial) and the scam-awareness norm in groups.
- https://www.threads.com/@valerieorsoni/post/DWEhhgKjbDb — Valerie Orsoni, March 2026: proves a publicly disclosed dosing protocol (200 µg/day × 15 days) from an established biohacker.
- https://www.instagram.com/reel/DcDt7BfsDio/ — @breedlove_22 (130K verified), Aug 2026: proves anecdotal cold/immune use with LL-37 + TA1 vials shown on camera.
- https://www.instagram.com/p/DdXoro1CvBU/ — @researchpeptidehq infographic: proves community-circulated dosing bands (50–250 mcg) and reconstitution examples.
- https://www.instagram.com/p/Dc67m0kDD0L/ — @peptaralabs_io carousel, Sept 2026: proves the most honest evidence-tier summary seen (preclinical + one 34-person topical trial, 2014).
Key specs table
| Property | Value |
|---|---|
| Amino acid sequence | [LL-37, 37 aa] (37 aa) |
| Molecular weight | 4,493.34 g/mol |
| Molecular formula | C205H340N60O53 |
| CAS | 154947-66-7 |
| Mechanism (as studied) | Cationic membrane disruption (pore formation in microbial membranes); immune modulation (chemotaxis, TLR2/4 signaling, NF-κB); biofilm disruption; wound healing (keratinocyte migration, angiogenesis) |
| Available forms | Lyophilized vials: 5 mg (most common), 10 mg; 10-vial kits; topical research use |
| Community-reported dosing (OBSERVED only, UNVERIFIED) | ~100 mcg SC titrated (observed pattern noted by @drharis.rana); 50–250 mcg examples (vendor infographics); Valerie Orsoni: 200 µg/day × 15 days. All anecdotal — no validated human systemic dose exists |
Note: one physician creator (@drharis.rana) described it as a "33-amino-acid" peptide in a reel; the correct length is 37 aa. Flagged as creator error, not adopted.
Pricing (observed 2026-09-20)
- Protide Health — 5 mg vial: $75.00 (https://protidehealth.com/product/ll-37-5mg/, listed price, observed 2026-09-20)
- Particle Peptides (EU) — 5 mg vial: €65.03 (https://particlepeptides.com/en/buy-peptides/94-ll-37-5mg.html, observed 2026-09-20)
- QSC — 10-vial 50 mg kit: $230 (https://qscpeptide.com/shop/qsc-ll-37-5mg-10-vial-kit-50mg-total-antimicrobial-peptide-kit/, observed 2026-09-20)
- TargetMol (lab-grade) — 5 mg $248 / 10 mg $389 (https://www.targetmol.com/compound/LL-37,%20Human%20acetate%28154947-66-7%20free%20base%29, observed 2026-09-20)
- Typical gray-market street range per community chatter: ~$60–90 for a 5 mg vial (qualitative pulse, not a verified price survey — UNVERIFIED)
- Facebook Marketplace used-range: none observed for LL-37.
What's included / what's needed
- Included: one lyophilized LL-37 vial (5 mg or 10 mg), typically with vendor COA link.
- Needed (per community practice, reported neutrally): bacteriostatic water for reconstitution, sterile insulin syringes, alcohol wipes, refrigerated storage. Vendor storage guidance varies: Protide Health says ≤6 °C sealed; Particle Peptides lists −20 °C long-term / 2–8 °C reconstituted 2–4 weeks.
Support reality
- Vendor support reputation: mixed and vendor-dependent; community discussion centers on sourcing rather than support quality. Scam warnings are a recurring theme ("Absolutely be aware of scams"), and coordinated vendor spam (spartanlab.shop / spartanlab dot shop) pollutes high-engagement threads.
- Counterfeit/fake concerns: high — repeatedly flagged in FB group threads and comment sections.
- COA/third-party testing: the quality-conscious minority demands it; QSC advertises Janoshik-independent COAs; Protide Health and Particle Peptides advertise HPLC-MS/≥99% purity. No community-verified independent purity survey found — UNVERIFIED territory.
Community verdict
LL-37 is the mold/Lyme/biofilm community's most hyped antimicrobial peptide, with real owner experimentation (folliculitis, sinus, colds) and educator reels driving demand — but the same threads carry the loudest safety counter-chorus of any peptide in this track: mast cell activation, autoimmune contraindications, and bleeding reports. Physician voices (@drharis.rana) and honest evidence-tiers (@peptaralabs_io: preclinical + one small topical trial) put the human systemic evidence base at thin, while sourcing stays a minefield of spam and scam warnings.
Regulatory & safety status
- Not an FDA-approved drug. LL-37 is sold as a research chemical "for research use only / not for human consumption." No approved drug formulation exists, despite it being an endogenous human peptide. It has been studied in preclinical and limited topical wound research, but there is no validated systemic human dosing.
- Community/labeled safety signals (observed data): mast cell activation warnings and autoimmune contraindications (Hashimoto's specifically named) in comment threads; bleeding reports in comments; painful local injection-site reactions (redness, swelling, pain) noted by a physician creator; pro-inflammatory associations in rosacea/psoriasis contexts per evidence summaries. Causality for the anecdotal adverse reports is UNVERIFIED.
Image view breakdown
5/8 obtained. All real vendor/retailer photos, converted to JPEG, saved under img/:
- hero:
ll-37-hero.jpg— Te Yi Peptide LL-37 5 mg vial product photo (teyipeptide.com) - side:
ll-37-side.jpg— Polaris Peptides LL-37 10 mg transparent-background product render (polarispeptides.com) - detail:
ll-37-detail.jpg— Novatide dark product-page image (novatidepeptide.com) - box:
ll-37-box.jpg— QSC single-vial render from their 10-vial kit listing (qscpeptide.com; not a true kit/packaging photo) - top:
ll-37-top.jpg— Bond Peptides LL-37 10 mg vial photo (directhealthshop.com)
Missing views (honestly not obtainable): rear, inuse (no real owner in-use photos surfaced), scale. The "box" slot holds an alternate vendor product shot — no item-specific kit/packaging photo was obtainable. Two initial candidates failed (smushcdn 403, cleanerpeptides 403) and were replaced with working alternates; no item was dropped.
Not medical advice. This is a research summary of publicly discussed information, not a recommendation to use any substance.
Sources
- Source: instagram.com — retrieval date not recorded
- Source: instagram.com — retrieval date not recorded
- Source: instagram.com — retrieval date not recorded
- Source: instagram.com — retrieval date not recorded
- Source: facebook.com — retrieval date not recorded
- Source: threads.com — retrieval date not recorded
- Source: instagram.com — retrieval date not recorded
- Source: instagram.com — retrieval date not recorded
- Source: instagram.com — retrieval date not recorded
- Source: protidehealth.com — retrieval date not recorded
- Source: particlepeptides.com — retrieval date not recorded
- Source: qscpeptide.com — retrieval date not recorded
- Source: targetmol.com — retrieval date not recorded