FOXO4-DRI

Published · Researched 2026-09-21

Overview

FOXO4-DRI is a synthetic D-retro-inverso senolytic peptide that disrupts the interaction between the FOXO4 transcription factor and the p53 tumor suppressor. In senescent cells, FOXO4 tethers p53 and blocks its pro-apoptotic signal; FOXO4-DRI competitively displaces FOXO4, freeing p53 to drive the senescent cell into programmed cell death while sparing healthy proliferating cells. Pioneered by the de Keizer group (Cell, 2017), it reversed age-related phenotypes in aged mice (kidney function, activity, fur density). It is a pure research compound with zero human trials: expensive, experimental, and firmly in the "lab reagent adopted by biohackers" bucket.

Social standing

  • Threads: @pep_scout (PepScout, Aug 2026) posted an educational summary — "FOXO4-DRI cleared senescent cells in mice by disrupting the FOXO4-p53 interaction. Researchers reported improvements in kidney function and activity in aged models" — plus a "comment RESEARCH for the full FOXO4-DRI breakdown" post noting "2026 research: reversed hippocampal atrophy and restored aortic function in aged mouse models. Zero human trials. Research compound only."
  • Web/community: No Facebook-group discussion found in accessible groups; no Instagram owner-use content identified. Presence is concentrated on research-chemical supplier pages (AdooQ, APExBIO, GlpBio, Real Peptides, Particle Peptides, NuVion) and biohacker long-form explainers.
  • Recurring praise: the most mechanistically precise senolytic concept in the peptide space — a single protein–protein interaction target rather than a broad-spectrum compound.
  • Recurring complaints/failure modes: extreme price per milligram; no human safety data whatsoever; D-retro-inverso synthesis makes it one of the costliest peptides to manufacture; grey-market quality is a gamble at these prices.

Social validation

  • Tier 3 — weak community validation. Included on genuine scientific pedigree (peer-reviewed mechanism, de Keizer Cell 2017) plus emerging biohacker-curator discussion, not on user-experience consensus.
  • Named sources and what each proves: (1) Threads @pep_scout posts (Aug 2026) prove the senolytic mechanism has reached biohacker-curator channels, with honest "zero human trials" framing; (2) supplier pages (AdooQ, APExBIO, GlpBio) prove it is a real, catalogued lab reagent with published specs, not a vaporware peptide; (3) Real Peptides / Particle Peptides / NuVion listings prove grey-market availability to non-institutional buyers.
  • No Facebook Marketplace listings observed; no verifiable owner before/after reports found.

Key specs table

Spec Value
Full name FOXO4-DRI (D-retro-inverso FOXO4)
CAS 2460055-10-9
Molecular formula C228H388N86O64
Molecular weight 5358.06 g/mol
Sequence D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
Length 46 residues, all D-amino acids (retro-inverso)
Mechanism Disrupts FOXO4–p53 interaction; selective senescent-cell apoptosis
Form Lyophilized powder, ≥98% purity (vendor-stated)
Storage Lyophilized at −20°C (stable ~36 months per AdooQ); aliquot solutions

Pricing

Dated street range (observed 2026-09-21): approximately $200–$535 per 10 mg vial, making it one of the most expensive peptides in this category. Anchors: AdooQ $135/1 mg, $370/5 mg, $535/10 mg; APExBIO $153/1 mg, $378/5 mg, $612/10 mg; Real Peptides $300/10 mg; Particle Peptides €214.99/10 mg; NuVion AUD $199–200; Sofix Health Peptides $281.99/10 mg; IndiaMart ₹3,200/10 mg (importer listing, authenticity UNVERIFIED). Facebook Marketplace observed range: none — no listings found.

What's included / what's needed

Included: lyophilized peptide vial only. Needed: bacteriostatic water for reconstitution, syringes, cold storage; given the price, a published third-party COA is non-negotiable. No established community protocol exists — dosing discussions are extrapolations from mouse studies, not recommendations.

Support reality

Lab-reagent suppliers (AdooQ, APExBIO, GlpBio) sell to institutions with standard chemical-supply terms; grey-market peptide vendors offer typical limited e-commerce support. No consumer-facing support, no medical guidance, no warranty of biological activity.

Regulatory & safety status

Research chemical only. Not FDA-approved and not EMA-approved for any indication. No human trials have been conducted; all efficacy and safety data are preclinical (mouse models). Sold strictly "for research use only — not for human consumption." The senolytic mechanism is biologically plausible but unproven in humans, and disrupting p53 biology carries theoretical oncogenic risk — UNVERIFIED in any human context.

Community verdict

FOXO4-DRI is the senolytic peptide with the cleanest mechanism on paper and the thinnest real-world footprint: admired by biohacker curators, priced out of casual experimentation, and entirely without human data. The honest community position is "fascinating mouse science, zero human evidence, do not treat as a usable intervention."

Images

5 real images on file (img/foxo4-dri-{hero,profile,top,detail,scale}.jpg). Hero verified 2026-09-21: genuine vendor vial photograph labeled "FOXO4-DRI 10MG — Research Use Only" (Peptides Lab UK). Remaining views downloaded from vendor galleries; product identity of profile/top/detail/scale not individually re-verified. Missing views: rear, in-use, box — no genuine traceable photos found; not substituted.

Not medical advice. This is a research summary only; FOXO4-DRI is an unapproved research chemical with no human safety data.

FOXO4-DRI — detail view
detail view Original vendor page URL not recorded in research dossier
FOXO4-DRI — hero view
hero view Original vendor page URL not recorded in research dossier
FOXO4-DRI — profile view
profile view Original vendor page URL not recorded in research dossier
FOXO4-DRI — scale view
scale view Original vendor page URL not recorded in research dossier
FOXO4-DRI — top view
top view Original vendor page URL not recorded in research dossier

Named sources

  • Threads @pep_scout posts (Aug 2026) — proves the senolytic mechanism has reached biohacker-curator channels, with honest "zero human trials" framing (Aug 2026)
  • supplier pages (AdooQ, APExBIO, GlpBio) — proves it is a real, catalogued lab reagent with published specs, not a vaporware peptide
  • Real Peptides / Particle Peptides / NuVion listings — proves grey-market availability to non-institutional buyers.
  • Threads — @pep_scout (PepScout, Aug 2026) posted an educational summary — "FOXO4-DRI cleared senescent cells in mice by disrupting the FOXO4-p53 interaction. (Aug 2026)
  • AdooQ — | Storage | Lyophilized at −20°C (stable ~36 months per AdooQ); aliquot solutions |

Source URLs were not recorded for these references.